PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G464700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 245aa    MW: 27526.7 Da    PI: 7.6775
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G464700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.71.5e-211978357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       +R+++tkeq+ +Le+l+++  r+p+ae++++++++l    +++ ++V++WFqN++a++++
  Aqcoe1G464700.1.p 19 SRWNPTKEQISILEALYKQgIRTPTAEQIQQITARLraygHIEGKNVFYWFQNHKARQRQ 78
                       7*****************99**************************************97 PP

2Wus_type_Homeobox118.13.9e-381880365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +RW+Pt+eQi iLe+lyk+G+rtP++e+iq+ita+L++yG+ie+kNVfyWFQN+kaR+rqkq
  Aqcoe1G464700.1.p 18 GSRWNPTKEQISILEALYKQGIRTPTAEQIQQITARLRAYGHIEGKNVFYWFQNHKARQRQKQ 80
                       68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.9811479IPR001356Homeobox domain
SMARTSM003891.1E-61683IPR001356Homeobox domain
SuperFamilySSF466893.68E-131786IPR009057Homeodomain-like
PfamPF000463.1E-191978IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.8E-91978IPR009057Homeodomain-like
CDDcd000863.46E-82080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEEDKNVDGS VSGGAAAGSR WNPTKEQISI LEALYKQGIR TPTAEQIQQI TARLRAYGHI  60
EGKNVFYWFQ NHKARQRQKQ KQENMVYLNQ YLQNTTTTAP VFSPSLCNNV GYSPYYIPQN  120
TTPPAFCYYP QYPKVPIPST NGLRRKQQRD KKMKEMSVGD GAVYHHAHKP YGIMHTGDMN  180
EESIHNNITS SINDETLALF PVHPTGILKE NSTTSFADNS HCDQDGIEVD CGAHTFIDFL  240
GHKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281161.12e-71PREDICTED: WUSCHEL-related homeobox 2
TrEMBLA0A061GX692e-62A0A061GX69_THECC; WUSCHEL related homeobox 2, putative
STRINGGLYMA11G14940.22e-59(Glycine max)
STRINGPGSC0003DMT4000779477e-60(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-46WUSCHEL related homeobox 2